HMGA1

HMGA1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HMGA1, HMG-R, HMGA1A, HMGIY, high mobility group AT-hook 1
Зовнішні ІД OMIM: 600701 MGI: 96160 HomoloGene: 128226 GeneCards: HMGA1
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 6: 34.24 – 34.25 Mb Хр. 17: 27.78 – 27.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HMGA1 (англ. High mobility group AT-hook 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 11 676[4].

Послідовність амінокислот
1020304050
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSE
VPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
ESSEEEQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література[ред. | ред. код]

  • Eckner R., Birnstiel M.L. (1989). Cloning of cDNAs coding for human HMG I and HMG Y proteins: both are capable of binding to the octamer sequence motif. Nucleic Acids Res. 17: 5947—5959. PMID 2505228 DOI:10.1093/nar/17.15.5947
  • Johnson K.R., Lehn D.A., Reeves R. (1989). Alternative processing of mRNAs encoding mammalian chromosomal high-mobility-group proteins HMG-I and HMG-Y. Mol. Cell. Biol. 9: 2114—2123. PMID 2701943 DOI:10.1128/MCB.9.5.2114
  • Friedmann M., Holth L.T., Zoghbi H.Y., Reeves R. (1993). Organization, inducible-expression and chromosome localization of the human HMG-I(Y) nonhistone protein gene. Nucleic Acids Res. 21: 4259—4267. PMID 8414980 DOI:10.1093/nar/21.18.4259
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Lund T., Dahl K.H., Mork E., Holtlund J., Laland S.G. (1987). The human chromosomal protein HMG I contains two identical palindrome amino acid sequences. Biochem. Biophys. Res. Commun. 146: 725—730. PMID 3619901 DOI:10.1016/0006-291X(87)90589-4
  • Karlson J.R., Mork E., Holtlund J., Laland S.G., Lund T. (1989). The amino acid sequence of the chromosomal protein HMG-Y, its relation to HMG-I and possible domains for the preferential binding of the proteins to stretches of A-T base pairs. Biochem. Biophys. Res. Commun. 158: 646—651. PMID 2920035 DOI:10.1016/0006-291X(89)92770-8

Примітки[ред. | ред. код]

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:5010 (англ.) . Процитовано 6 вересня 2017.
  4. UniProt, P17096 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 6 вересня 2017.

Див. також[ред. | ред. код]